SCOPe 2.08: Domain d2jxha_: 2jxh A:

Lineage for d2jxha_ (2jxh A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families)
   formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon

5. Family a.43.1.11: PutA pre-N-terminal region-like [158485] (2 proteins)
   in PutA it forms a separate ribbon-helix-helix domain connected to the N-terminal enzymatic domain by a flexible linker

6. Protein automated matches [190663] (2 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:303] [255305] (3 PDB entries)

8. Domain d2jxha_: 2jxh A: [242302]
   automated match to d2gpeb_

Details for d2jxha_

PDB Entry: 2jxh

PDB Description: solution structure of dna binding domain of proline utilization a (puta) for psuedomonas putida

PDB Compounds: (A:) proline dehydrogenase

SCOPe Domain Sequences for d2jxha_:

Sequence; same for both SEQRES and ATOM records:

>d2jxha_ a.43.1.11 (A:) automated matches {Pseudomonas putida [TaxId: 303]}
matttlgvklddptrerlkaaaqsidrtphwlikqaifnylekle

Timeline for d2jxha_:

• d2jxha_ first appeared in SCOPe 2.04
  
• d2jxha_ appears in SCOPe 2.07