SCOPe 2.04: Domain d2jxgb_: 2jxg B:

Lineage for d2jxgb_ (2jxg B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families)
   formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon

5. Family a.43.1.11: PutA pre-N-terminal region-like [158485] (2 proteins)
   in PutA it forms a separate ribbon-helix-helix domain connected to the N-terminal enzymatic domain by a flexible linker

6. Protein automated matches [190663] (2 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:303] [255305] (3 PDB entries)

8. Domain d2jxgb_: 2jxg B: [242301]
   automated match to d2gpeb_

Details for d2jxgb_

PDB Entry: 2jxg

PDB Description: solution structure of the dna binding domain of proline utilization a (puta)

PDB Compounds: (B:) proline dehydrogenase

SCOPe Domain Sequences for d2jxgb_:

Sequence; same for both SEQRES and ATOM records:

>d2jxgb_ a.43.1.11 (B:) automated matches {Pseudomonas putida [TaxId: 303]}
matttlgvklddptrerlkaaaqsidrtphwlikqaifnylekle

Timeline for d2jxgb_:

• d2jxgb_ is new in SCOPe 2.04-stable
  
• d2jxgb_ appears in SCOPe 2.05
  
• d2jxgb_ appears in the current release, SCOPe 2.08