Class b: All beta proteins [48724] (177 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) many known members contain KOW motif |
Family b.34.5.4: N-utilization substance G protein NusG, C-terminal domain [82072] (2 proteins) |
Protein N-utilization substance G protein NusG, C-terminal domain [82073] (3 species) |
Species Escherichia coli [TaxId:562] [255301] (1 PDB entry) |
Domain d2jvva_: 2jvv A: [242296] automated match to d1nz9a_ |
PDB Entry: 2jvv (more details)
SCOPe Domain Sequences for d2jvva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jvva_ b.34.5.4 (A:) N-utilization substance G protein NusG, C-terminal domain {Escherichia coli [TaxId: 562]} rpktlfepgemvrvndgpfadfngvveevdyeksrlkvsvsifgratpveldfsqveka
Timeline for d2jvva_: