Lineage for d2jvva_ (2jvv A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2054645Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 2054895Family b.34.5.4: N-utilization substance G protein NusG, C-terminal domain [82072] (2 proteins)
  6. 2054896Protein N-utilization substance G protein NusG, C-terminal domain [82073] (3 species)
  7. 2054907Species Escherichia coli [TaxId:562] [255301] (1 PDB entry)
  8. 2054908Domain d2jvva_: 2jvv A: [242296]
    automated match to d1nz9a_

Details for d2jvva_

PDB Entry: 2jvv (more details)

PDB Description: Solution Structure of E. coli NusG carboxyterminal domain
PDB Compounds: (A:) Transcription antitermination protein nusG

SCOPe Domain Sequences for d2jvva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jvva_ b.34.5.4 (A:) N-utilization substance G protein NusG, C-terminal domain {Escherichia coli [TaxId: 562]}
rpktlfepgemvrvndgpfadfngvveevdyeksrlkvsvsifgratpveldfsqveka

SCOPe Domain Coordinates for d2jvva_:

Click to download the PDB-style file with coordinates for d2jvva_.
(The format of our PDB-style files is described here.)

Timeline for d2jvva_: