SCOPe 2.08: Domain d2jvja1: 2jvj A:1-124

Lineage for d2jvja1 (2jvj A:1-124)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein Sporulation response regulator Spo0F [52188] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [52189] (12 PDB entries)
   Uniprot P06628

8. Domain d2jvja1: 2jvj A:1-124 [242294]
   Other proteins in same PDB: d2jvja2
   automated match to d2fspa_
   mutant

Details for d2jvja1

PDB Entry: 2jvj

PDB Description: nmr solution structure of the hyper-sporulation response regulator spo0f mutant i90a from bacillus subtilis

PDB Compounds: (A:) sporulation initiation phosphotransferase f

SCOPe Domain Sequences for d2jvja1:

Sequence; same for both SEQRES and ATOM records:

>d2jvja1 c.23.1.1 (A:1-124) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]}
mmnekilivddqygirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgm
dgieilkrmkvidenirviimtaygeldmaqeskelgalthfakpfdideirdavkkylp
lksn

Timeline for d2jvja1:

• d2jvja1 first appeared in SCOPe 2.04, called d2jvja_
  
• d2jvja1 appears in SCOPe 2.07