SCOPe 2.05: Domain d2jvda_: 2jvd A:

Lineage for d2jvda_ (2jvd A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.21: YnzC-like [158221] (1 family)

5. Family a.2.21.1: YznC-like [158222] (2 proteins)
   Pfam PF05979; DUF896

6. Protein automated matches [190889] (1 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [188291] (2 PDB entries)

8. Domain d2jvda_: 2jvd A: [242292]
   automated match to d3bhpc_

Details for d2jvda_

PDB Entry: 2jvd

PDB Description: solution nmr structure of the folded n-terminal fragment of upf0291 protein ynzc from bacillus subtilis. northeast structural genomics target sr384-1-46

PDB Compounds: (A:) UPF0291 protein ynzC

SCOPe Domain Sequences for d2jvda_:

Sequence; same for both SEQRES and ATOM records:

>d2jvda_ a.2.21.1 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
misnakiarinelaakakagviteeekaeqqklrqeylkgfrssmkle

Timeline for d2jvda_:

• d2jvda_ first appeared in SCOPe 2.04
  
• d2jvda_ is called d2jvda1 in SCOPe 2.06
  
• d2jvda_ appears in the current release, SCOPe 2.08, called d2jvda1