SCOPe 2.08: Domain d2jvda1: 2jvd A:1-46

Lineage for d2jvda1 (2jvd A:1-46)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.21: YnzC-like [158221] (1 family)

5. Family a.2.21.1: YznC-like [158222] (2 proteins)
   Pfam PF05979; DUF896

6. Protein automated matches [190889] (1 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [188291] (2 PDB entries)

8. Domain d2jvda1: 2jvd A:1-46 [242292]
   Other proteins in same PDB: d2jvda2
   automated match to d3bhpc_

Details for d2jvda1

PDB Entry: 2jvd

PDB Description: solution nmr structure of the folded n-terminal fragment of upf0291 protein ynzc from bacillus subtilis. northeast structural genomics target sr384-1-46

PDB Compounds: (A:) UPF0291 protein ynzC

SCOPe Domain Sequences for d2jvda1:

Sequence; same for both SEQRES and ATOM records:

>d2jvda1 a.2.21.1 (A:1-46) automated matches {Bacillus subtilis [TaxId: 1423]}
misnakiarinelaakakagviteeekaeqqklrqeylkgfrssmk

Timeline for d2jvda1:

• d2jvda1 first appeared in SCOPe 2.04, called d2jvda_
  
• d2jvda1 appears in SCOPe 2.07