SCOPe 2.06: Domain d2jv6a_: 2jv6 A:

Lineage for d2jv6a_ (2jv6 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (55 species)
   not a true protein

7. Species Yellow fever virus [TaxId:11089] [255299] (1 PDB entry)

8. Domain d2jv6a_: 2jv6 A: [242289]
   automated match to d1s6na_

Details for d2jv6a_

PDB Entry: 2jv6

PDB Description: yf ed3 protein nmr structure

PDB Compounds: (A:) Envelope protein E

SCOPe Domain Sequences for d2jv6a_:

Sequence; same for both SEQRES and ATOM records:

>d2jv6a_ b.1.18.0 (A:) automated matches {Yellow fever virus [TaxId: 11089]}
msaltlkgtsykmctdkmsfvknptdtghgtvvmqvkvpkgapckipvivaddltaaink
gilvtvnpiastnddevlievnppfgdsyiivgtgdsrltyqwhkegssigk

Timeline for d2jv6a_:

• d2jv6a_ first appeared in SCOPe 2.04
  
• d2jv6a_ appears in SCOPe 2.05
  
• d2jv6a_ appears in SCOPe 2.07
  
• d2jv6a_ appears in the current release, SCOPe 2.08