![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) ![]() |
![]() | Family b.34.9.4: CPH domain [159021] (2 proteins) automatically mapped to Pfam PF11515 |
![]() | Protein automated matches [254565] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255297] (1 PDB entry) |
![]() | Domain d2jufa_: 2juf A: [242287] automated match to d2jnga1 |
PDB Entry: 2juf (more details)
SCOPe Domain Sequences for d2jufa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jufa_ b.34.9.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ygeyvqqtlqpgmrvrmlddyeeisagdegefrqsnngippvqvfwqstgrtywvhwhml eilg
Timeline for d2jufa_: