Lineage for d2jufa_ (2juf A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784517Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2784795Family b.34.9.4: CPH domain [159021] (2 proteins)
    automatically mapped to Pfam PF11515
  6. 2784799Protein automated matches [254565] (1 species)
    not a true protein
  7. 2784800Species Human (Homo sapiens) [TaxId:9606] [255297] (1 PDB entry)
  8. 2784801Domain d2jufa_: 2juf A: [242287]
    automated match to d2jnga1

Details for d2jufa_

PDB Entry: 2juf (more details)

PDB Description: nmr solution structure of parc cph domain. nesg target hr3443b/sgc- toronto
PDB Compounds: (A:) p53-associated parkin-like cytoplasmic protein

SCOPe Domain Sequences for d2jufa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jufa_ b.34.9.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ygeyvqqtlqpgmrvrmlddyeeisagdegefrqsnngippvqvfwqstgrtywvhwhml
eilg

SCOPe Domain Coordinates for d2jufa_:

Click to download the PDB-style file with coordinates for d2jufa_.
(The format of our PDB-style files is described here.)

Timeline for d2jufa_: