Class g: Small proteins [56992] (94 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) |
Family g.39.1.0: automated matches [191378] (1 protein) not a true family |
Protein automated matches [190463] (7 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187379] (11 PDB entries) |
Domain d2jtga1: 2jtg A:1-81 [242286] Other proteins in same PDB: d2jtga2 automated match to d2d8ra1 complexed with zn |
PDB Entry: 2jtg (more details)
SCOPe Domain Sequences for d2jtga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jtga1 g.39.1.0 (A:1-81) automated matches {Human (Homo sapiens) [TaxId: 9606]} mvqscsaygcknrydkdkpvsfhkfpltrpslckeweaavrrknfkptkyssicsehftp dcfkrecnnkllkenavptif
Timeline for d2jtga1: