Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.4: Laminin G-like module [49944] (7 proteins) |
Protein Laminin alpha2 chain [49947] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [49948] (3 PDB entries) |
Domain d1qu0d_: 1qu0 D: [24228] fifth G-like module complexed with ca, so4 |
PDB Entry: 1qu0 (more details), 2.35 Å
SCOPe Domain Sequences for d1qu0d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qu0d_ b.29.1.4 (D:) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} sgtyfdgtgfakavggfkvgldllvefefrttrptgvllgissqkmdgmgiemideklmf hvdngagrftaiydaeipghmcngqwhkvtakkiknrlelvvdgnqvdaqspnsastsad tndpvfvggfpgglnqfglttnirfrgcirslkltkgtgkplevnfakalelrgvqpvsc p
Timeline for d1qu0d_: