Lineage for d1qu0d_ (1qu0 D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779532Family b.29.1.4: Laminin G-like module [49944] (7 proteins)
  6. 2779548Protein Laminin alpha2 chain [49947] (1 species)
  7. 2779549Species Mouse (Mus musculus) [TaxId:10090] [49948] (3 PDB entries)
  8. 2779553Domain d1qu0d_: 1qu0 D: [24228]
    fifth G-like module
    complexed with ca, so4

Details for d1qu0d_

PDB Entry: 1qu0 (more details), 2.35 Å

PDB Description: crystal structure of the fifth laminin g-like module of the mouse laminin alpha2 chain
PDB Compounds: (D:) laminin alpha2 chain

SCOPe Domain Sequences for d1qu0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qu0d_ b.29.1.4 (D:) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]}
sgtyfdgtgfakavggfkvgldllvefefrttrptgvllgissqkmdgmgiemideklmf
hvdngagrftaiydaeipghmcngqwhkvtakkiknrlelvvdgnqvdaqspnsastsad
tndpvfvggfpgglnqfglttnirfrgcirslkltkgtgkplevnfakalelrgvqpvsc
p

SCOPe Domain Coordinates for d1qu0d_:

Click to download the PDB-style file with coordinates for d1qu0d_.
(The format of our PDB-style files is described here.)

Timeline for d1qu0d_: