Lineage for d2js7a1 (2js7 A:2-152)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2438981Superfamily c.23.2: Toll/Interleukin receptor TIR domain [52200] (2 families) (S)
  5. 2439001Family c.23.2.0: automated matches [196997] (1 protein)
    not a true family
  6. 2439002Protein automated matches [196998] (2 species)
    not a true protein
  7. 2439003Species Human (Homo sapiens) [TaxId:9606] [196999] (5 PDB entries)
  8. 2439008Domain d2js7a1: 2js7 A:2-152 [242278]
    Other proteins in same PDB: d2js7a2, d2js7a3
    automated match to d4eo7a_

Details for d2js7a1

PDB Entry: 2js7 (more details)

PDB Description: solution nmr structure of human myeloid differentiation primary response (myd88). northeast structural genomics target hr2869a
PDB Compounds: (A:) Myeloid differentiation primary response protein MyD88

SCOPe Domain Sequences for d2js7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2js7a1 c.23.2.0 (A:2-152) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gittlddplghmperfdaficycpsdiqfvqemirqleqtnyrlklcvsdrdvlpgtcvw
siaseliekrcrrmvvvvsddylqskecdfqtkfalslspgahqkrlipikykamkkefp
silrfitvcdytnpctkswfwtrlakalslp

SCOPe Domain Coordinates for d2js7a1:

Click to download the PDB-style file with coordinates for d2js7a1.
(The format of our PDB-style files is described here.)

Timeline for d2js7a1: