SCOPe 2.08: Domain d2js7a1: 2js7 A:2-152

Lineage for d2js7a1 (2js7 A:2-152)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.2: Toll/Interleukin receptor TIR domain [52200] (2 families)

5. Family c.23.2.0: automated matches [196997] (1 protein)
   not a true family

6. Protein automated matches [196998] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [196999] (9 PDB entries)

8. Domain d2js7a1: 2js7 A:2-152 [242278]
   Other proteins in same PDB: d2js7a2, d2js7a3
   automated match to d4eo7a_

Details for d2js7a1

PDB Entry: 2js7

PDB Description: solution nmr structure of human myeloid differentiation primary response (myd88). northeast structural genomics target hr2869a

PDB Compounds: (A:) Myeloid differentiation primary response protein MyD88

SCOPe Domain Sequences for d2js7a1:

Sequence; same for both SEQRES and ATOM records:

>d2js7a1 c.23.2.0 (A:2-152) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gittlddplghmperfdaficycpsdiqfvqemirqleqtnyrlklcvsdrdvlpgtcvw
siaseliekrcrrmvvvvsddylqskecdfqtkfalslspgahqkrlipikykamkkefp
silrfitvcdytnpctkswfwtrlakalslp

Timeline for d2js7a1:

• d2js7a1 first appeared in SCOPe 2.04, called d2js7a_
  
• d2js7a1 appears in SCOPe 2.07