SCOPe 2.08: Domain d2js4a1: 2js4 A:1-62

Lineage for d2js4a1 (2js4 A:1-62)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.171: Trm112p-like [158996] (1 superfamily)
   similar to the small domain of the ISP (50021)

4. Superfamily b.171.1: Trm112p-like [158997] (2 families)
   possibly have evolved from a metal ion (or cofactor)-binding protein of a rubredoxin-like fold; in the known members, from one to three of the four metal-binding positions are occupied by cysteine residues

5. Family b.171.1.0: automated matches [254245] (1 protein)
   not a true family

6. Protein automated matches [254562] (2 species)
   not a true protein

7. Species Bordetella bronchiseptica [TaxId:257310] [255293] (1 PDB entry)

8. Domain d2js4a1: 2js4 A:1-62 [242277]
   Other proteins in same PDB: d2js4a2
   automated match to d2hf1a1

Details for d2js4a1

PDB Entry: 2js4

PDB Description: solution nmr structure of bordetella bronchiseptica protein bb2007. northeast structural genomics consortium target bor54

PDB Compounds: (A:) UPF0434 protein BB2007

SCOPe Domain Sequences for d2js4a1:

Sequence; same for both SEQRES and ATOM records:

>d2js4a1 b.171.1.0 (A:1-62) automated matches {Bordetella bronchiseptica [TaxId: 257310]}
mesrlldilvcpvckgrlefqraqaelvcnadrlafpvrdgvpimleaearsldaeapaq
ps

Timeline for d2js4a1:

• d2js4a1 first appeared in SCOPe 2.04, called d2js4a_
  
• d2js4a1 appears in SCOPe 2.07