SCOPe 2.06: Domain d2jrla_: 2jrl A:

Lineage for d2jrla_ (2jrl A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (71 species)
   not a true protein

7. Species Aquifex aeolicus [TaxId:224324] [255008] (2 PDB entries)

8. Domain d2jrla_: 2jrl A: [242272]
   automated match to d1j56a_

Details for d2jrla_

PDB Entry: 2jrl

PDB Description: solution structure of the beryllofluoride-activated ntrc4 receiver domain dimer

PDB Compounds: (A:) transcriptional regulator (NtrC family)

SCOPe Domain Sequences for d2jrla_:

Sequence; same for both SEQRES and ATOM records:

>d2jrla_ c.23.1.0 (A:) automated matches {Aquifex aeolicus [TaxId: 224324]}
mkrvlvvddeesitsslsaileeegyhpdtaktlreaekkikelffpvivldvwmpdgdg
vnfidfikenspdsvvivitghgsvdtavkaikkgayeflekpfsverflltikhafeey
s

Timeline for d2jrla_:

• d2jrla_ first appeared in SCOPe 2.04
  
• d2jrla_ appears in SCOPe 2.05
  
• d2jrla_ appears in SCOPe 2.07
  
• d2jrla_ appears in the current release, SCOPe 2.08