Lineage for d2jrha1 (2jrh A:1-85)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933606Superfamily d.15.2: CAD & PB1 domains [54277] (3 families) (S)
    contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily
  5. 2933622Family d.15.2.2: PB1 domain [64225] (11 proteins)
    Pfam PF00564
    forms heterodimers, although not all PB1 domain pairs associate.
  6. 2933644Protein Mitogen-activated protein kinase kinase kinase 3, MEKK 3 [142978] (1 species)
  7. 2933645Species Human (Homo sapiens) [TaxId:9606] [142979] (3 PDB entries)
    Uniprot Q99759 42-123! Uniprot Q99759 43-122
  8. 2933648Domain d2jrha1: 2jrh A:1-85 [242271]
    Other proteins in same PDB: d2jrha2
    automated match to d2cu1a1

Details for d2jrha1

PDB Entry: 2jrh (more details)

PDB Description: solution structure of human mekk3 pb1 domain cis isomer
PDB Compounds: (A:) Mitogen-activated protein kinase kinase kinase 3

SCOPe Domain Sequences for d2jrha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jrha1 d.15.2.2 (A:1-85) Mitogen-activated protein kinase kinase kinase 3, MEKK 3 {Human (Homo sapiens) [TaxId: 9606]}
qsdvrikfehngerriiafsrpvkyedvehkvttvfgqpldlhymnnelsillknqddld
kaidildrsssmkslrilllsqdrn

SCOPe Domain Coordinates for d2jrha1:

Click to download the PDB-style file with coordinates for d2jrha1.
(The format of our PDB-style files is described here.)

Timeline for d2jrha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2jrha2