![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) ![]() |
![]() | Family c.56.3.0: automated matches [193325] (1 protein) not a true family |
![]() | Protein automated matches [193326] (11 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:83332] [225299] (7 PDB entries) |
![]() | Domain d2jrca_: 2jrc A: [242270] automated match to d1ryna_ |
PDB Entry: 2jrc (more details)
SCOPe Domain Sequences for d2jrca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jrca_ c.56.3.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} maepllvvglgnpganyartrhnlgfvvadllaarlgakfkahkrsgaevatgrsagrsl vlakprcymnesgrqigplakfysvapaniivihddldlefgrirlkigggegghnglrs vvaalgtkdfqrvrigigrppgrkdpaafvlenftpaeraevpticeqaadatellieqg mepaqnrvhaw
Timeline for d2jrca_: