SCOPe 2.06: Domain d1qu0c_: 1qu0 C:

Lineage for d1qu0c_ (1qu0 C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.4: Laminin G-like module [49944] (7 proteins)

6. Protein Laminin alpha2 chain [49947] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49948] (3 PDB entries)

8. Domain d1qu0c_: 1qu0 C: [24227]
   fifth G-like module
   complexed with ca, so4

Details for d1qu0c_

PDB Entry: 1qu0, 2.35 Å

PDB Description: crystal structure of the fifth laminin g-like module of the mouse laminin alpha2 chain

PDB Compounds: (C:) laminin alpha2 chain

SCOPe Domain Sequences for d1qu0c_:

Sequence; same for both SEQRES and ATOM records:

>d1qu0c_ b.29.1.4 (C:) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]}
esgtyfdgtgfakavggfkvgldllvefefrttrptgvllgissqkmdgmgiemideklm
fhvdngagrftaiydaeipghmcngqwhkvtakkiknrlelvvdgnqvdaqspnsastsa
dtndpvfvggfpgglnqfglttnirfrgcirslkltkgtgkplevnfakalelrgvqpvs
cpt

Timeline for d1qu0c_:

• d1qu0c_ first appeared (with stable ids) in SCOP 1.55
  
• d1qu0c_ appears in SCOPe 2.05
  
• d1qu0c_ appears in SCOPe 2.07
  
• d1qu0c_ appears in the current release, SCOPe 2.08