| Class g: Small proteins [56992] (100 folds) |
| Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.17: CSL zinc finger [144217] (2 families) ![]() |
| Family g.41.17.1: CSL zinc finger [144218] (3 proteins) Pfam PF05207 |
| Protein automated matches [254561] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [255290] (1 PDB entry) |
| Domain d2jr7a1: 2jr7 A:1-81 [242269] Other proteins in same PDB: d2jr7a2 automated match to d1wgea1 complexed with zn |
PDB Entry: 2jr7 (more details)
SCOPe Domain Sequences for d2jr7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jr7a1 g.41.17.1 (A:1-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mavfhdeveiedfqydedsetyfypcpcgdnfsitkedlengedvatcpscsliikviyd
kdqfvsgetvpapsankelvk
Timeline for d2jr7a1: