Lineage for d2jr7a1 (2jr7 A:1-81)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3037409Superfamily g.41.17: CSL zinc finger [144217] (2 families) (S)
  5. 3037410Family g.41.17.1: CSL zinc finger [144218] (3 proteins)
    Pfam PF05207
  6. 3037418Protein automated matches [254561] (2 species)
    not a true protein
  7. 3037421Species Human (Homo sapiens) [TaxId:9606] [255290] (1 PDB entry)
  8. 3037422Domain d2jr7a1: 2jr7 A:1-81 [242269]
    Other proteins in same PDB: d2jr7a2
    automated match to d1wgea1
    complexed with zn

Details for d2jr7a1

PDB Entry: 2jr7 (more details)

PDB Description: solution structure of human desr1
PDB Compounds: (A:) DPH3 homolog

SCOPe Domain Sequences for d2jr7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jr7a1 g.41.17.1 (A:1-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mavfhdeveiedfqydedsetyfypcpcgdnfsitkedlengedvatcpscsliikviyd
kdqfvsgetvpapsankelvk

SCOPe Domain Coordinates for d2jr7a1:

Click to download the PDB-style file with coordinates for d2jr7a1.
(The format of our PDB-style files is described here.)

Timeline for d2jr7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2jr7a2