SCOPe 2.08: Domain d2jr5a1: 2jr5 A:1-86

Lineage for d2jr5a1 (2jr5 A:1-86)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.218: YgfY-like [109909] (1 superfamily)
   5 helices; array; forms a tight dimer in crystals

4. Superfamily a.218.1: YgfY-like [109910] (2 families)

5. Family a.218.1.0: automated matches [254244] (1 protein)
   not a true family

6. Protein automated matches [254560] (3 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [255289] (1 PDB entry)

8. Domain d2jr5a1: 2jr5 A:1-86 [242267]
   Other proteins in same PDB: d2jr5a2
   automated match to d1puza_

Details for d2jr5a1

PDB Entry: 2jr5

PDB Description: solution structure of upf0350 protein vc_2471. northeast structural genomics target vcr36

PDB Compounds: (A:) UPF0350 protein VC_2471

SCOPe Domain Sequences for d2jr5a1:

Sequence; same for both SEQRES and ATOM records:

>d2jr5a1 a.218.1.0 (A:1-86) automated matches {Vibrio cholerae [TaxId: 666]}
mytaeqkarikwacrrgmleldvvimpffeecfdslteseqddfvallesddpdlfawvm
ghgrcenlglaamvdkivahnlskvr

Timeline for d2jr5a1:

• d2jr5a1 first appeared in SCOPe 2.04, called d2jr5a_
  
• d2jr5a1 appears in SCOPe 2.07