SCOPe 2.08: Domain d2jptb_: 2jpt B:

Lineage for d2jptb_ (2jpt B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (2 proteins)
   dimer: subunits are made of two EF-hands

6. Protein Calcyclin (S100) [47479] (17 species)

7. Species Cow (Bos taurus), s100b [TaxId:9913] [47482] (26 PDB entries)

8. Domain d2jptb_: 2jpt B: [242263]
   automated match to d2k2fa1
   complexed with bme

Details for d2jptb_

PDB Entry: 2jpt

PDB Description: structural changes induced in apo-s100a1 protein by the disulphide formation between its cys85 residue and b-mercaptoethanol

PDB Compounds: (B:) Protein S100-A1

SCOPe Domain Sequences for d2jptb_:

Sequence; same for both SEQRES and ATOM records:

>d2jptb_ a.39.1.2 (B:) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]}
gseletametlinvfhahsgkegdkyklskkelkellqtelsgfldaqkdadavdkvmke
ldedgdgevdfqeyvvlvaaltvacnnffwens

Timeline for d2jptb_:

• d2jptb_ first appeared in SCOPe 2.04
  
• d2jptb_ appears in SCOPe 2.07