SCOPe 2.06: Domain d2jppb_: 2jpp B:

Lineage for d2jppb_ (2jpp B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.151: CsrA-like [117129] (1 superfamily)
   sandwich; 10 strands in 2 sheets; intertwined dimer (segment-swapped, 5-stranded greek-key sandwich?)

4. Superfamily b.151.1: CsrA-like [117130] (2 families)

5. Family b.151.1.1: CsrA-like [117131] (2 proteins)
   Pfam PF02599

6. Protein automated matches [190528] (3 species)
   not a true protein

7. Species Pseudomonas fluorescens [TaxId:294] [255284] (6 PDB entries)

8. Domain d2jppb_: 2jpp B: [242261]
   automated match to d2btia_
   protein/RNA complex

Details for d2jppb_

PDB Entry: 2jpp

PDB Description: structural basis of rsma/csra rna recognition: structure of rsme bound to the shine-dalgarno sequence of hcna mrna

PDB Compounds: (B:) Translational repressor

SCOPe Domain Sequences for d2jppb_:

Sequence; same for both SEQRES and ATOM records:

>d2jppb_ b.151.1.1 (B:) automated matches {Pseudomonas fluorescens [TaxId: 294]}
mliltrkvgesinigddititilgvsgqqvriginapkdvavhreeiyqriqa

Timeline for d2jppb_:

• d2jppb_ first appeared in SCOPe 2.04
  
• d2jppb_ appears in SCOPe 2.05
  
• d2jppb_ appears in SCOPe 2.07
  
• d2jppb_ appears in the current release, SCOPe 2.08