SCOP 1.65: Domain d1qu0b_: 1qu0 B:

Lineage for d1qu0b_ (1qu0 B:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families)

5. Family b.29.1.4: Laminin G-like module [49944] (4 proteins)

6. Protein Laminin alpha2 chain [49947] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49948] (2 PDB entries)

8. Domain d1qu0b_: 1qu0 B: [24226]

Details for d1qu0b_

PDB Entry: 1qu0, 2.35 Å

PDB Description: crystal structure of the fifth laminin g-like module of the mouse laminin alpha2 chain

SCOP Domain Sequences for d1qu0b_:

Sequence; same for both SEQRES and ATOM records:

>d1qu0b_ b.29.1.4 (B:) Laminin alpha2 chain {Mouse (Mus musculus)}
sgtyfdgtgfakavggfkvgldllvefefrttrptgvllgissqkmdgmgiemideklmf
hvdngagrftaiydaeipghmcngqwhkvtakkiknrlelvvdgnqvdaqspnsastsad
tndpvfvggfpgglnqfglttnirfrgcirslkltkgtgkplevnfakalelrgvqpvsc
p

Timeline for d1qu0b_:

• d1qu0b_ first appeared (with stable ids) in SCOP 1.55
  
• d1qu0b_ appears in SCOP 1.63
  
• d1qu0b_ appears in SCOP 1.67
  
• d1qu0b_ appears in the current release, SCOPe 2.08