Lineage for d2joma_ (2jom A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2498997Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 2498998Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 2498999Family d.6.1.1: Prion-like [54099] (3 protein domains)
  6. 2499063Protein automated matches [191016] (9 species)
    not a true protein
  7. 2499100Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [226669] (6 PDB entries)
  8. 2499108Domain d2joma_: 2jom A: [242256]
    automated match to d3o79b_
    mutant

Details for d2joma_

PDB Entry: 2jom (more details)

PDB Description: NMR structure of rabbit prion protein mutation I214V
PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d2joma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2joma_ d.6.1.1 (A:) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
lggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvdqysnqnsfvhdcvnitv
kqhtvttttkgenftetdikimervveqmcvtqyqqesqaayqra

SCOPe Domain Coordinates for d2joma_:

Click to download the PDB-style file with coordinates for d2joma_.
(The format of our PDB-style files is described here.)

Timeline for d2joma_: