SCOPe 2.06: Domain d2joja_: 2joj A:

Lineage for d2joja_ (2joj A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.0: automated matches [191396] (1 protein)
   not a true family

6. Protein automated matches [190513] (30 species)
   not a true protein

7. Species Euplotes octocarinatus [TaxId:5937] [255282] (1 PDB entry)

8. Domain d2joja_: 2joj A: [242255]
   automated match to d1n0ya_

Details for d2joja_

PDB Entry: 2joj

PDB Description: nmr solution structure of n-terminal domain of euplotes octocarinatus centrin

PDB Compounds: (A:) Centrin protein

SCOPe Domain Sequences for d2joja_:

Sequence; same for both SEQRES and ATOM records:

>d2joja_ a.39.1.0 (A:) automated matches {Euplotes octocarinatus [TaxId: 5937]}
lseeqkqeikeafdlfdtnktgsidyhelkvamralgfdvkkpeilelmneydregngyi
gfddfldimtekiknrd

Timeline for d2joja_:

• d2joja_ first appeared in SCOPe 2.04
  
• d2joja_ appears in SCOPe 2.05
  
• d2joja_ appears in SCOPe 2.07
  
• d2joja_ appears in the current release, SCOPe 2.08