SCOPe 2.08: Domain d2jnza1: 2jnz A:12-108

Lineage for d2jnza1 (2jnz A:12-108)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.3: PHL pollen allergen [49590] (2 families)

5. Family b.7.3.0: automated matches [191612] (1 protein)
   not a true family

6. Protein automated matches [191118] (2 species)
   not a true protein

7. Species Timothy grass (Phleum pratense) [TaxId:15957] [189184] (3 PDB entries)

8. Domain d2jnza1: 2jnz A:12-108 [242252]
   Other proteins in same PDB: d2jnza2
   automated match to d3ft1c_

Details for d2jnza1

PDB Entry: 2jnz

PDB Description: solution structure of phl p 3, a major allergen from timothy grass pollen

PDB Compounds: (A:) Phl p 3 allergen

SCOPe Domain Sequences for d2jnza1:

Sequence; same for both SEQRES and ATOM records:

>d2jnza1 b.7.3.0 (A:12-108) automated matches {Timothy grass (Phleum pratense) [TaxId: 15957]}
avqvtftvqkgsdpkklvldikytrpgdslaevelrqhgseewepltkkgnvwevksskp
lvgpfnfrfmskggmrnvfdeviptafsigktykpee

Timeline for d2jnza1:

• d2jnza1 first appeared in SCOPe 2.04, called d2jnza_
  
• d2jnza1 appears in SCOPe 2.07