Lineage for d2jnxa_ (2jnx A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2711591Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 2711592Protein automated matches [190513] (36 species)
    not a true protein
  7. 2711627Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [255281] (1 PDB entry)
  8. 2711628Domain d2jnxa_: 2jnx A: [242251]
    automated match to d2dfsb1
    complexed with ca

Details for d2jnxa_

PDB Entry: 2jnx (more details)

PDB Description: nmr derived solution structure of an ef-hand calcium binding protein from entamoeba histolytica
PDB Compounds: (A:) Calcium binding protein 2

SCOPe Domain Sequences for d2jnxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jnxa_ a.39.1.0 (A:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
maealfkqldangdgsvsyeevkafvsskrpikneqllqlifkaididgngeidlaeftk
faaavkeqdlsdekvglkilyklmdadgdgkltkeevttffkkfgyekvvdqimkadang
dgyitleeflafnl

SCOPe Domain Coordinates for d2jnxa_:

Click to download the PDB-style file with coordinates for d2jnxa_.
(The format of our PDB-style files is described here.)

Timeline for d2jnxa_: