![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.0: automated matches [191396] (1 protein) not a true family |
![]() | Protein automated matches [190513] (36 species) not a true protein |
![]() | Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [255281] (1 PDB entry) |
![]() | Domain d2jnxa_: 2jnx A: [242251] automated match to d2dfsb1 complexed with ca |
PDB Entry: 2jnx (more details)
SCOPe Domain Sequences for d2jnxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jnxa_ a.39.1.0 (A:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} maealfkqldangdgsvsyeevkafvsskrpikneqllqlifkaididgngeidlaeftk faaavkeqdlsdekvglkilyklmdadgdgkltkeevttffkkfgyekvvdqimkadang dgyitleeflafnl
Timeline for d2jnxa_: