Lineage for d2jnva_ (2jnv A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904630Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 1904817Superfamily d.52.8: Fe-S cluster assembly (FSCA) domain-like [117916] (3 families) (S)
    similar putative active site with a conserved cysteine residue
  5. 1904849Family d.52.8.0: automated matches [191619] (1 protein)
    not a true family
  6. 1904850Protein automated matches [191134] (3 species)
    not a true protein
  7. 1904861Species Rice (Oryza sativa) [TaxId:4530] [255280] (1 PDB entry)
  8. 1904862Domain d2jnva_: 2jnv A: [242250]
    automated match to d1xhja_

Details for d2jnva_

PDB Entry: 2jnv (more details)

PDB Description: Solution structure of C-terminal domain of NifU-like protein from Oryza sativa
PDB Compounds: (A:) NifU-like protein 1, chloroplast

SCOPe Domain Sequences for d2jnva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jnva_ d.52.8.0 (A:) automated matches {Rice (Oryza sativa) [TaxId: 4530]}
mglpltagnvesvldqvrpyltadggdvalheiagnvvrlklqgacgscpsslitikrgi
errlmekipdvaavepvtdketg

SCOPe Domain Coordinates for d2jnva_:

Click to download the PDB-style file with coordinates for d2jnva_.
(The format of our PDB-style files is described here.)

Timeline for d2jnva_: