Lineage for d2jnta_ (2jnt A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2340532Superfamily a.118.21: Chemosensory protein Csp2 [100910] (2 families) (S)
    automatically mapped to Pfam PF03392
  5. 2340533Family a.118.21.1: Chemosensory protein Csp2 [81898] (2 proteins)
  6. 2340543Protein automated matches [254557] (1 species)
    not a true protein
  7. 2340544Species Silkworm (Bombyx mori) [TaxId:7091] [255279] (1 PDB entry)
  8. 2340545Domain d2jnta_: 2jnt A: [242248]
    automated match to d1k19a_

Details for d2jnta_

PDB Entry: 2jnt (more details)

PDB Description: structure of bombyx mori chemosensory protein 1 in solution
PDB Compounds: (A:) Chemosensory protein CSP1

SCOPe Domain Sequences for d2jnta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jnta_ a.118.21.1 (A:) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
ytdkydkinlqeilenkrllesymdcvlgkgkctpegkelkdhlqealetgcekcteaqe
kgaetsidylikneleiwkeltahfdpdgkwrkkyedrakakgivipe

SCOPe Domain Coordinates for d2jnta_:

Click to download the PDB-style file with coordinates for d2jnta_.
(The format of our PDB-style files is described here.)

Timeline for d2jnta_: