| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.21: Chemosensory protein Csp2 [100910] (2 families) ![]() automatically mapped to Pfam PF03392 |
| Family a.118.21.1: Chemosensory protein Csp2 [81898] (2 proteins) |
| Protein automated matches [254557] (1 species) not a true protein |
| Species Silkworm (Bombyx mori) [TaxId:7091] [255279] (1 PDB entry) |
| Domain d2jnta_: 2jnt A: [242248] automated match to d1k19a_ |
PDB Entry: 2jnt (more details)
SCOPe Domain Sequences for d2jnta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jnta_ a.118.21.1 (A:) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
ytdkydkinlqeilenkrllesymdcvlgkgkctpegkelkdhlqealetgcekcteaqe
kgaetsidylikneleiwkeltahfdpdgkwrkkyedrakakgivipe
Timeline for d2jnta_: