SCOPe 2.06: Domain d2jnta_: 2jnt A:

Lineage for d2jnta_ (2jnt A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.21: Chemosensory protein Csp2 [100910] (2 families)
   automatically mapped to Pfam PF03392

5. Family a.118.21.1: Chemosensory protein Csp2 [81898] (2 proteins)

6. Protein automated matches [254557] (1 species)
   not a true protein

7. Species Silkworm (Bombyx mori) [TaxId:7091] [255279] (1 PDB entry)

8. Domain d2jnta_: 2jnt A: [242248]
   automated match to d1k19a_

Details for d2jnta_

PDB Entry: 2jnt

PDB Description: structure of bombyx mori chemosensory protein 1 in solution

PDB Compounds: (A:) Chemosensory protein CSP1

SCOPe Domain Sequences for d2jnta_:

Sequence; same for both SEQRES and ATOM records:

>d2jnta_ a.118.21.1 (A:) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
ytdkydkinlqeilenkrllesymdcvlgkgkctpegkelkdhlqealetgcekcteaqe
kgaetsidylikneleiwkeltahfdpdgkwrkkyedrakakgivipe

Timeline for d2jnta_:

• d2jnta_ first appeared in SCOPe 2.04
  
• d2jnta_ appears in SCOPe 2.05
  
• d2jnta_ appears in SCOPe 2.07
  
• d2jnta_ appears in the current release, SCOPe 2.08