SCOPe 2.04: Domain d2jn8a_: 2jn8 A:

Lineage for d2jn8a_ (2jn8 A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.247: YoaC-like [140669] (1 superfamily)
   5 helices; bundle, one crossover connection, the arrangement of the first four helices is similar to the KaiA/RbsU domain fold (101214)

4. Superfamily a.247.1: YoaC-like [140670] (1 family)
   automatically mapped to Pfam PF08986

5. Family a.247.1.1: YoaC-like [140671] (2 proteins)

6. Protein automated matches [254555] (1 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:602] [255276] (1 PDB entry)

8. Domain d2jn8a_: 2jn8 A: [242244]
   automated match to d2es9a1

Details for d2jn8a_

PDB Entry: 2jn8

PDB Description: solution nmr structure of q8zrj2 from salmonella typhimurium. northeast structural genomics target str65.

PDB Compounds: (A:) putative cytoplasmic protein

SCOPe Domain Sequences for d2jn8a_:

Sequence; same for both SEQRES and ATOM records:

>d2jn8a_ a.247.1.1 (A:) automated matches {Salmonella typhimurium [TaxId: 602]}
vnfkdksmptaiekaldfiggmntsasvphsmdestakgilkylhdlgvpvspevvvarg
eqegwnpeftkkvagwaekvasgnriliknpeyfstymqeqlkelvleh

Timeline for d2jn8a_:

• d2jn8a_ is new in SCOPe 2.04-stable
  
• d2jn8a_ appears in SCOPe 2.05
  
• d2jn8a_ appears in the current release, SCOPe 2.08, called d2jn8a1