![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.247: YoaC-like [140669] (1 superfamily) 5 helices; bundle, one crossover connection, the arrangement of the first four helices is similar to the KaiA/RbsU domain fold (101214) |
![]() | Superfamily a.247.1: YoaC-like [140670] (1 family) ![]() automatically mapped to Pfam PF08986 |
![]() | Family a.247.1.1: YoaC-like [140671] (2 proteins) |
![]() | Protein automated matches [254555] (1 species) not a true protein |
![]() | Species Salmonella typhimurium [TaxId:602] [255276] (1 PDB entry) |
![]() | Domain d2jn8a1: 2jn8 A:2-109 [242244] Other proteins in same PDB: d2jn8a2 automated match to d2es9a1 |
PDB Entry: 2jn8 (more details)
SCOPe Domain Sequences for d2jn8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jn8a1 a.247.1.1 (A:2-109) automated matches {Salmonella typhimurium [TaxId: 602]} vnfkdksmptaiekaldfiggmntsasvphsmdestakgilkylhdlgvpvspevvvarg eqegwnpeftkkvagwaekvasgnriliknpeyfstymqeqlkelvle
Timeline for d2jn8a1: