SCOPe 2.08: Domain d2jn8a1: 2jn8 A:2-109

Lineage for d2jn8a1 (2jn8 A:2-109)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.247: YoaC-like [140669] (1 superfamily)
   5 helices; bundle, one crossover connection, the arrangement of the first four helices is similar to the KaiA/RbsU domain fold (101214)

4. Superfamily a.247.1: YoaC-like [140670] (1 family)
   automatically mapped to Pfam PF08986

5. Family a.247.1.1: YoaC-like [140671] (2 proteins)

6. Protein automated matches [254555] (1 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:602] [255276] (1 PDB entry)

8. Domain d2jn8a1: 2jn8 A:2-109 [242244]
   Other proteins in same PDB: d2jn8a2
   automated match to d2es9a1

Details for d2jn8a1

PDB Entry: 2jn8

PDB Description: solution nmr structure of q8zrj2 from salmonella typhimurium. northeast structural genomics target str65.

PDB Compounds: (A:) putative cytoplasmic protein

SCOPe Domain Sequences for d2jn8a1:

Sequence; same for both SEQRES and ATOM records:

>d2jn8a1 a.247.1.1 (A:2-109) automated matches {Salmonella typhimurium [TaxId: 602]}
vnfkdksmptaiekaldfiggmntsasvphsmdestakgilkylhdlgvpvspevvvarg
eqegwnpeftkkvagwaekvasgnriliknpeyfstymqeqlkelvle

Timeline for d2jn8a1:

• d2jn8a1 first appeared in SCOPe 2.04, called d2jn8a_
  
• d2jn8a1 appears in SCOPe 2.07