Lineage for d2jmma_ (2jmm A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021955Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3021956Superfamily f.4.1: OMPA-like [56925] (5 families) (S)
    forms (8,10) barrel
  5. 3021957Family f.4.1.1: Outer membrane protein [56926] (3 proteins)
    automatically mapped to Pfam PF13505
  6. 3021958Protein Outer membrane protein A (OMPA) transmembrane domain [56927] (1 species)
  7. 3021959Species Escherichia coli [TaxId:562] [56928] (5 PDB entries)
  8. 3021962Domain d2jmma_: 2jmm A: [242243]
    automated match to d1g90a_

Details for d2jmma_

PDB Entry: 2jmm (more details)

PDB Description: nmr solution structure of a minimal transmembrane beta-barrel platform protein
PDB Compounds: (A:) outer membrane protein a

SCOPe Domain Sequences for d2jmma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jmma_ f.4.1.1 (A:) Outer membrane protein A (OMPA) transmembrane domain {Escherichia coli [TaxId: 562]}
mpkdntwytgaklgwsqysrenqlgagafggyqvnpyvgfemgydwlgrmprkaqgvqlt
aklgypklgtddldiytrlggmvwradtsdkdgngyisaaeasvspvfaggveyvirrri
tpeiatrleyqwtnnasdngmlslgvsyrfgqgeaa

SCOPe Domain Coordinates for d2jmma_:

Click to download the PDB-style file with coordinates for d2jmma_.
(The format of our PDB-style files is described here.)

Timeline for d2jmma_: