![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies) dimetal(zinc)-bound alpha+beta fold |
![]() | Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) ![]() |
![]() | Family g.50.1.0: automated matches [191482] (1 protein) not a true family |
![]() | Protein automated matches [190772] (6 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255275] (1 PDB entry) |
![]() | Domain d2jmia_: 2jmi A: [242242] automated match to d2qica_ complexed with zn |
PDB Entry: 2jmi (more details)
SCOPe Domain Sequences for d2jmia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jmia_ g.50.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} qeevycfcrnvsygpmvacdnpacpfewfhygcvglkqapkgkwycskdckeianqrsks
Timeline for d2jmia_: