Lineage for d2jmia_ (2jmi A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037862Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
    dimetal(zinc)-bound alpha+beta fold
  4. 3037863Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) (S)
  5. 3037962Family g.50.1.0: automated matches [191482] (1 protein)
    not a true family
  6. 3037963Protein automated matches [190772] (6 species)
    not a true protein
  7. 3037964Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255275] (1 PDB entry)
  8. 3037965Domain d2jmia_: 2jmi A: [242242]
    automated match to d2qica_
    complexed with zn

Details for d2jmia_

PDB Entry: 2jmi (more details)

PDB Description: nmr solution structure of phd finger fragment of yeast yng1 protein in free state
PDB Compounds: (A:) Protein YNG1

SCOPe Domain Sequences for d2jmia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jmia_ g.50.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qeevycfcrnvsygpmvacdnpacpfewfhygcvglkqapkgkwycskdckeianqrsks

SCOPe Domain Coordinates for d2jmia_:

Click to download the PDB-style file with coordinates for d2jmia_.
(The format of our PDB-style files is described here.)

Timeline for d2jmia_: