![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
![]() | Family b.34.2.1: SH3-domain [50045] (40 proteins) |
![]() | Protein alpha-Spectrin, SH3 domain [50058] (1 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [50059] (38 PDB entries) |
![]() | Domain d2jmaa1: 2jma A:2-62 [242240] Other proteins in same PDB: d2jmaa2 automated match to d2f2va_ |
PDB Entry: 2jma (more details)
SCOPe Domain Sequences for d2jmaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jmaa1 b.34.2.1 (A:2-62) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} detgkelvlalydyqekspaevtmkkgdiltllnstnkdwwkvevndrqgfvpaayvkkl d
Timeline for d2jmaa1: