![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) ![]() has additional strand at N-terminus |
![]() | Family b.1.8.0: automated matches [191527] (1 protein) not a true family |
![]() | Protein automated matches [190890] (7 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255273] (1 PDB entry) |
![]() | Domain d2jlpd_: 2jlp D: [242237] automated match to d3f7la_ complexed with cu, scn, zn |
PDB Entry: 2jlp (more details), 1.7 Å
SCOPe Domain Sequences for d2jlpd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jlpd_ b.1.8.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ddgtlhaacqvqpsatldaaqprvtgvvlfrqlaprakldaffalegfptepnsssraih vhqfgdlsqgcestgphynplavphpqhpgdfgnfavrdgslwryraglaaslagphsiv gravvvhageddlgrggnqasvengnagrrlaccvvgvcgpglwerqar
Timeline for d2jlpd_: