Lineage for d2jlpc_ (2jlp C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763708Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2764467Family b.1.8.0: automated matches [191527] (1 protein)
    not a true family
  6. 2764468Protein automated matches [190890] (7 species)
    not a true protein
  7. 2764481Species Human (Homo sapiens) [TaxId:9606] [255273] (1 PDB entry)
  8. 2764484Domain d2jlpc_: 2jlp C: [242236]
    automated match to d3f7la_
    complexed with cu, scn, zn

Details for d2jlpc_

PDB Entry: 2jlp (more details), 1.7 Å

PDB Description: crystal structure of human extracellular copper-zinc superoxide dismutase.
PDB Compounds: (C:) extracellular superoxide dismutase (cu-zn)

SCOPe Domain Sequences for d2jlpc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jlpc_ b.1.8.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dgtlhaacqvqpsatldaaqprvtgvvlfrqlaprakldaffalegfptepnsssraihv
hqfgdlsqgcestgphynplavphpqhpgdfgnfavrdgslwryraglaaslagphsivg
ravvvhageddlgrggnqasvengnagrrlaccvvgvcgpglwerqa

SCOPe Domain Coordinates for d2jlpc_:

Click to download the PDB-style file with coordinates for d2jlpc_.
(The format of our PDB-style files is described here.)

Timeline for d2jlpc_: