Lineage for d2jlja_ (2jlj A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011638Fold d.367: EscU C-terminal domain-like [160543] (1 superfamily)
    alpha-beta(3)-alpha-beta-alpha(2); 3 layers, a/b/a; mixed beta-sheet, order: 4123, strand 2 is antiparallel to the rest
  4. 3011639Superfamily d.367.1: EscU C-terminal domain-like [160544] (2 families) (S)
  5. 3011657Family d.367.1.0: automated matches [191577] (1 protein)
    not a true family
  6. 3011658Protein automated matches [191013] (4 species)
    not a true protein
  7. 3011668Species Yersinia pestis [TaxId:632] [188779] (3 PDB entries)
  8. 3011670Domain d2jlja_: 2jlj A: [242233]
    automated match to d3bzra1
    mutant

Details for d2jlja_

PDB Entry: 2jlj (more details), 1.3 Å

PDB Description: crystal structure of the cytoplasmic domain of yersinia pestis yscu n263a p264a mutant
PDB Compounds: (A:) Yop proteins translocation protein U

SCOPe Domain Sequences for d2jlja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jlja_ d.367.1.0 (A:) automated matches {Yersinia pestis [TaxId: 632]}
gspeikskrrqfhqeiqsrnmrenvkrssvvvaaathiaigilykrgetplplvtfkytd
aqvqtvrkiaeeegvpilqriplaralywdalvdhyipaeqieataevlrwlerq

SCOPe Domain Coordinates for d2jlja_:

Click to download the PDB-style file with coordinates for d2jlja_.
(The format of our PDB-style files is described here.)

Timeline for d2jlja_: