Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.367: EscU C-terminal domain-like [160543] (1 superfamily) alpha-beta(3)-alpha-beta-alpha(2); 3 layers, a/b/a; mixed beta-sheet, order: 4123, strand 2 is antiparallel to the rest |
Superfamily d.367.1: EscU C-terminal domain-like [160544] (2 families) |
Family d.367.1.0: automated matches [191577] (1 protein) not a true family |
Protein automated matches [191013] (4 species) not a true protein |
Species Yersinia pestis [TaxId:632] [188779] (3 PDB entries) |
Domain d2jlja_: 2jlj A: [242233] automated match to d3bzra1 mutant |
PDB Entry: 2jlj (more details), 1.3 Å
SCOPe Domain Sequences for d2jlja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jlja_ d.367.1.0 (A:) automated matches {Yersinia pestis [TaxId: 632]} gspeikskrrqfhqeiqsrnmrenvkrssvvvaaathiaigilykrgetplplvtfkytd aqvqtvrkiaeeegvpilqriplaralywdalvdhyipaeqieataevlrwlerq
Timeline for d2jlja_: