SCOPe 2.07: Domain d2jiub_: 2jiu B:

Lineage for d2jiub_ (2jiu B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (892 PDB entries)

8. Domain d2jiub_: 2jiu B: [242231]
   automated match to d3ikaa_
   complexed with aee; mutant

Details for d2jiub_

PDB Entry: 2jiu, 3.05 Å

PDB Description: crystal structure of egfr kinase domain t790m mutation in complex with aee788

PDB Compounds: (B:) Epidermal growth factor receptor

SCOPe Domain Sequences for d2jiub_:

Sequence; same for both SEQRES and ATOM records:

>d2jiub_ d.144.1.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspk
ankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyl
lnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaegg
kvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlp
qppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptd
snfyralmde

Timeline for d2jiub_:

• d2jiub_ first appeared in SCOPe 2.04
  
• d2jiub_ appears in SCOPe 2.06
  
• d2jiub_ appears in the current release, SCOPe 2.08