Lineage for d2jiua_ (2jiu A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1931583Protein automated matches [190091] (12 species)
    not a true protein
  7. 1931656Species Human (Homo sapiens) [TaxId:9606] [188447] (553 PDB entries)
  8. 1932361Domain d2jiua_: 2jiu A: [242230]
    automated match to d3ikaa_
    complexed with aee; mutant

Details for d2jiua_

PDB Entry: 2jiu (more details), 3.05 Å

PDB Description: crystal structure of egfr kinase domain t790m mutation in complex with aee788
PDB Compounds: (A:) Epidermal growth factor receptor

SCOPe Domain Sequences for d2jiua_:

Sequence, based on SEQRES records: (download)

>d2jiua_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
geapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspka
nkeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyll
nwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggk
vpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpq
ppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptds
nfyralmdeedmddvvdadey

Sequence, based on observed residues (ATOM records): (download)

>d2jiua_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
geapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspka
nkeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyll
nwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggk
vpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpq
ppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpspvvd
adey

SCOPe Domain Coordinates for d2jiua_:

Click to download the PDB-style file with coordinates for d2jiua_.
(The format of our PDB-style files is described here.)

Timeline for d2jiua_: