Lineage for d2jitb_ (2jit B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1931583Protein automated matches [190091] (12 species)
    not a true protein
  7. 1931656Species Human (Homo sapiens) [TaxId:9606] [188447] (553 PDB entries)
  8. 1932320Domain d2jitb_: 2jit B: [242229]
    automated match to d3ikaa_
    mutant

Details for d2jitb_

PDB Entry: 2jit (more details), 3.1 Å

PDB Description: crystal structure of egfr kinase domain t790m mutation
PDB Compounds: (B:) Epidermal growth factor receptor

SCOPe Domain Sequences for d2jitb_:

Sequence, based on SEQRES records: (download)

>d2jitb_ d.144.1.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkan
keildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqylln
wcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggkv
pikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqp
pictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptdsn
fyralmdeedmddvvdadeyli

Sequence, based on observed residues (ATOM records): (download)

>d2jitb_ d.144.1.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkan
keildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqylln
wcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggkv
pikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqp
pictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdelptdsnfyral
mdevvdadeyli

SCOPe Domain Coordinates for d2jitb_:

Click to download the PDB-style file with coordinates for d2jitb_.
(The format of our PDB-style files is described here.)

Timeline for d2jitb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2jita_