Lineage for d2jija_ (2jij A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1558339Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1559062Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 1559412Family b.82.2.15: proly-4-hydroxylase (P4H, PHD) like [254173] (3 proteins)
    Pfam PF13640; PubMed 16782814
  6. 1559420Protein automated matches [254532] (2 species)
    not a true protein
  7. 1559421Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [255264] (2 PDB entries)
  8. 1559425Domain d2jija_: 2jij A: [242225]
    automated match to d2jiga_
    complexed with cl

Details for d2jija_

PDB Entry: 2jij (more details), 2.9 Å

PDB Description: crystal structure of the apo form of chlamydomonas reinhardtii prolyl-4 hydroxylase type i
PDB Compounds: (A:) prolyl-4 hydroxylase

SCOPe Domain Sequences for d2jija_:

Sequence, based on SEQRES records: (download)

>d2jija_ b.82.2.15 (A:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mvgfgelkeewrgevvhlswsprafllknflsdeecdyivekarpkmvkssvvdnesgks
vdseirtstgtwfakgedsviskiekrvaqvtmiplenheglqvlhyhdgqkyephydyf
hdpvnagpehggqrvvtmlmylttveeggetvlpnaeqkvtgdgwsecakrglavkpikg
dalmfyslkpdgsndpaslhgscptlkgdkwsatkwihvapigg

Sequence, based on observed residues (ATOM records): (download)

>d2jija_ b.82.2.15 (A:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mvgfgelkeewrgevvhlswsprafllknflsdeecdyivekarpkmvkrtstgtwfakg
edsviskiekrvaqvtmiplenheglqvlhyhdgqkyephydyfhdpvnagpehggqrvv
tmlmylttveeggetvlpnaeqkvtgwsecakrglavkpikgdalmfyslkpdgsndpas
lhgscptlkgdkwsatkwihvapigg

SCOPe Domain Coordinates for d2jija_:

Click to download the PDB-style file with coordinates for d2jija_.
(The format of our PDB-style files is described here.)

Timeline for d2jija_: