SCOPe 2.05: Domain d2jigb_: 2jig B:

Lineage for d2jigb_ (2jig B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.15: proly-4-hydroxylase (P4H, PHD) like [254173] (3 proteins)
   Pfam PF13640; PubMed 16782814

6. Protein P4H-1 [254393] (1 species)

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [254829] (1 PDB entry)

8. Domain d2jigb_: 2jig B: [242224]
   complexed with gol, pd2, so4, zn

Details for d2jigb_

PDB Entry: 2jig, 1.85 Å

PDB Description: crystal structure of chlamydomonas reinhardtii prolyl-4 hydroxylase type i complexed with zinc and pyridine-2,4-dicarboxylate

PDB Compounds: (B:) prolyl-4 hydroxylase

SCOPe Domain Sequences for d2jigb_:

Sequence, based on SEQRES records:

>d2jigb_ b.82.2.15 (B:) P4H-1 {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
eewrgevvhlswsprafllknflsdeecdyivekarpkmvkssvvdnesgksvdseirts
tgtwfakgedsviskiekrvaqvtmiplenheglqvlhyhdgqkyephydyfhdpvnagp
ehggqrvvtmlmylttveeggetvlpnaeqkvtgdgwsecakrglavkpikgdalmfysl
kpdgsndpaslhgscptlkgdkwsatkwihvapigg

Sequence, based on observed residues (ATOM records):

>d2jigb_ b.82.2.15 (B:) P4H-1 {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
eewrgevvhlswsprafllknflsdeecdyivekarpkmtstgtwfakgedsviskiekr
vaqvtmiplenheglqvlhyhqkyephydyfhdpvnagpehggqrvvtmlmylttveegg
etvlpnaeqkvtgdgwsecakrglavkpikgdalmfyslkpdgsndpaslhgscptlkgd
kwsatkwihvapigg

Timeline for d2jigb_:

• d2jigb_ first appeared in SCOPe 2.04
  
• d2jigb_ appears in SCOPe 2.06
  
• d2jigb_ appears in the current release, SCOPe 2.08