Lineage for d2jigb_ (2jig B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2404605Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2405353Family b.82.2.15: proly-4-hydroxylase (P4H, PHD) like [254173] (3 protein domains)
    Pfam PF13640; PubMed 16782814
  6. 2405357Protein P4H-1 [254393] (1 species)
  7. 2405358Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [254829] (1 PDB entry)
  8. 2405360Domain d2jigb_: 2jig B: [242224]
    complexed with gol, pd2, so4, zn

Details for d2jigb_

PDB Entry: 2jig (more details), 1.85 Å

PDB Description: crystal structure of chlamydomonas reinhardtii prolyl-4 hydroxylase type i complexed with zinc and pyridine-2,4-dicarboxylate
PDB Compounds: (B:) prolyl-4 hydroxylase

SCOPe Domain Sequences for d2jigb_:

Sequence, based on SEQRES records: (download)

>d2jigb_ b.82.2.15 (B:) P4H-1 {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
eewrgevvhlswsprafllknflsdeecdyivekarpkmvkssvvdnesgksvdseirts
tgtwfakgedsviskiekrvaqvtmiplenheglqvlhyhdgqkyephydyfhdpvnagp
ehggqrvvtmlmylttveeggetvlpnaeqkvtgdgwsecakrglavkpikgdalmfysl
kpdgsndpaslhgscptlkgdkwsatkwihvapigg

Sequence, based on observed residues (ATOM records): (download)

>d2jigb_ b.82.2.15 (B:) P4H-1 {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
eewrgevvhlswsprafllknflsdeecdyivekarpkmtstgtwfakgedsviskiekr
vaqvtmiplenheglqvlhyhqkyephydyfhdpvnagpehggqrvvtmlmylttveegg
etvlpnaeqkvtgdgwsecakrglavkpikgdalmfyslkpdgsndpaslhgscptlkgd
kwsatkwihvapigg

SCOPe Domain Coordinates for d2jigb_:

Click to download the PDB-style file with coordinates for d2jigb_.
(The format of our PDB-style files is described here.)

Timeline for d2jigb_: