Lineage for d1f5fa_ (1f5f A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779532Family b.29.1.4: Laminin G-like module [49944] (7 proteins)
  6. 2779593Protein Sex hormone-binding globulin [49945] (1 species)
  7. 2779594Species Human (Homo sapiens) [TaxId:9606] [49946] (9 PDB entries)
  8. 2779598Domain d1f5fa_: 1f5f A: [24222]
    complexed with ca, dht, ipa, zn

Details for d1f5fa_

PDB Entry: 1f5f (more details), 1.7 Å

PDB Description: crystal structure of the n-terminal g-domain of shbg in complex with zinc
PDB Compounds: (A:) sex hormone-binding globulin

SCOPe Domain Sequences for d1f5fa_:

Sequence, based on SEQRES records: (download)

>d1f5fa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]}
ppavhlsngpgqepiavmtfdltkitktsssfevrtwdpegvifygdtnpkddwfmlglr
dgrpeiqlhnhwaqltvgagprlddgrwhqvevkmegdsvllevdgeevlrlrqvsgplt
skrhpimrialggllfpasnlrlplvpaldgclrrdswldkqaeisasaptslrsc

Sequence, based on observed residues (ATOM records): (download)

>d1f5fa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]}
ppavhlsngpgqepiavmtfdltkitktsssfevrtwdpegvifygdtnpkddwfmlglr
dgrpeiqlhnhwaqltvgagprlddgrwhqvevkmegdsvllevdgeevlrlrqvsgplh
pimrialggllfpasnlrlplvpaldgclrrdswldkqaeisasaptslrsc

SCOPe Domain Coordinates for d1f5fa_:

Click to download the PDB-style file with coordinates for d1f5fa_.
(The format of our PDB-style files is described here.)

Timeline for d1f5fa_: