Lineage for d2jf6a_ (2jf6 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (90 species)
    not a true protein
  7. 2084128Species Rauvolfia serpentina [TaxId:4060] [189830] (12 PDB entries)
  8. 2084147Domain d2jf6a_: 2jf6 A: [242218]
    automated match to d1hxjb_
    complexed with s55; mutant

Details for d2jf6a_

PDB Entry: 2jf6 (more details), 2.82 Å

PDB Description: Structure of inactive mutant of Strictosidine Glucosidase in complex with strictosidine
PDB Compounds: (A:) strictosidine-o-beta-d-glucosidase

SCOPe Domain Sequences for d2jf6a_:

Sequence, based on SEQRES records: (download)

>d2jf6a_ c.1.8.0 (A:) automated matches {Rauvolfia serpentina [TaxId: 4060]}
vvhrrdfpqdfifgaggsayqcegaynegnrgpsiwdtftqrspakisdgsngnqaincy
hmykedikimkqtglesyrfsiswsrvlpggrlaagvnkdgvkfyhdfidellangikps
vtlfhwdlpqaledeyggflshrivddfceyaefcfwefgdkikywttfnephtfavngy
algefapgrggkgdegdpaiepyvvthnillahkaaveeyrnkfqkcqegeigivlnsmw
meplsdvqadidaqkraldfmlgwfleplttgdypksmrelvkgrlpkfsaddseklkgc
ydfigmnyytatyvtnavksnseklsyetddqvtktfernqkpighalyggwqhvvpwgl
ykllvytketyhvpvlyvtesgmveenktkillsearrdaertdyhqkhlasvrdaiddg
vnvkgyfvwsffdnfewnlgyicrygiihvdyksferypkesaiwyknfiag

Sequence, based on observed residues (ATOM records): (download)

>d2jf6a_ c.1.8.0 (A:) automated matches {Rauvolfia serpentina [TaxId: 4060]}
vvhrrdfpqdfifgaggsayqcegaynegnrgpsiwdtftqrspakisdgsngnqincyh
mykedikimkqtglesyrfsiswsrvlpggrlaagvnkdgvkfyhdfidellangikpsv
tlfhwdlpqaledeyggflshrivddfceyaefcfwefgdkikywttfnephtfavngya
lgefapgrggkgdegdpaiepyvvthnillahkaaveeyrnkfqkcqegeigivlnsmwm
eplsdvqadidaqkraldfmlgwfleplttgdypksmrelvkgrlpkfsaddseklkgcy
dfigmnyytatyvtnalsyetddqvtktfernqkpighalyggwqhvvpwglykllvytk
etyhvpvlyvtesgmveenktkillsearrdaertdyhqkhlasvrdaiddgvnvkgyfv
wsffdnfewnlgyicrygiihvdyksferypkesaiwyknfiag

SCOPe Domain Coordinates for d2jf6a_:

Click to download the PDB-style file with coordinates for d2jf6a_.
(The format of our PDB-style files is described here.)

Timeline for d2jf6a_: