SCOPe 2.06: Domain d2jeoa1: 2jeo A:22-235

Lineage for d2jeoa1 (2jeo A:22-235)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.6: Phosphoribulokinase/pantothenate kinase [52584] (6 proteins)

6. Protein automated matches [227115] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255256] (2 PDB entries)

8. Domain d2jeoa1: 2jeo A:22-235 [242217]
   Other proteins in same PDB: d2jeoa2
   automated match to d1uj2a_

Details for d2jeoa1

PDB Entry: 2jeo, 2.5 Å

PDB Description: crystal structure of human uridine-cytidine kinase 1

PDB Compounds: (A:) uridine-cytidine kinase 1

SCOPe Domain Sequences for d2jeoa1:

Sequence, based on SEQRES records:

>d2jeoa1 c.37.1.6 (A:22-235) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rpfligvsggtasgkstvcekimellgqneveqrqrkvvilsqdrfykvltaeqkakalk
gqynfdhpdafdndlmhrtlknivegktvevptydfvthsrlpettvvypadvvlfegil
vfysqeirdmfhlrlfvdtdsdvrlsrrvlrdvrrgrdleqiltqyttfvkpafeefclp
tkkyadviiprgvdnmvainlivqhiqdilngdi

Sequence, based on observed residues (ATOM records):

>d2jeoa1 c.37.1.6 (A:22-235) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rpfligvsggtasgkstvcekimellgqneveqrqrkvvilsqdrfykvltaeqkakalk
gqynfdhpdafdndlmhrtlknivegktvevptydfvthsrlpettvvypadvvlfegil
vfysqeirdmfhlrlfvdtdsdvrlsrrvlrdvrdleqiltqyttfvkpafeefclptkk
yadviiprgvdnmvainlivqhiqdilngdi

Timeline for d2jeoa1:

• d2jeoa1 first appeared in SCOPe 2.04, called d2jeoa_
  
• d2jeoa1 was called d2jeoa_ in SCOPe 2.05
  
• d2jeoa1 appears in SCOPe 2.07
  
• d2jeoa1 appears in the current release, SCOPe 2.08