Lineage for d2jeoa1 (2jeo A:22-235)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110026Family c.37.1.6: Phosphoribulokinase/pantothenate kinase [52584] (6 protein domains)
  6. 2110066Protein automated matches [227115] (2 species)
    not a true protein
  7. 2110067Species Human (Homo sapiens) [TaxId:9606] [255256] (2 PDB entries)
  8. 2110068Domain d2jeoa1: 2jeo A:22-235 [242217]
    Other proteins in same PDB: d2jeoa2
    automated match to d1uj2a_

Details for d2jeoa1

PDB Entry: 2jeo (more details), 2.5 Å

PDB Description: crystal structure of human uridine-cytidine kinase 1
PDB Compounds: (A:) uridine-cytidine kinase 1

SCOPe Domain Sequences for d2jeoa1:

Sequence, based on SEQRES records: (download)

>d2jeoa1 c.37.1.6 (A:22-235) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rpfligvsggtasgkstvcekimellgqneveqrqrkvvilsqdrfykvltaeqkakalk
gqynfdhpdafdndlmhrtlknivegktvevptydfvthsrlpettvvypadvvlfegil
vfysqeirdmfhlrlfvdtdsdvrlsrrvlrdvrrgrdleqiltqyttfvkpafeefclp
tkkyadviiprgvdnmvainlivqhiqdilngdi

Sequence, based on observed residues (ATOM records): (download)

>d2jeoa1 c.37.1.6 (A:22-235) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rpfligvsggtasgkstvcekimellgqneveqrqrkvvilsqdrfykvltaeqkakalk
gqynfdhpdafdndlmhrtlknivegktvevptydfvthsrlpettvvypadvvlfegil
vfysqeirdmfhlrlfvdtdsdvrlsrrvlrdvrdleqiltqyttfvkpafeefclptkk
yadviiprgvdnmvainlivqhiqdilngdi

SCOPe Domain Coordinates for d2jeoa1:

Click to download the PDB-style file with coordinates for d2jeoa1.
(The format of our PDB-style files is described here.)

Timeline for d2jeoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2jeoa2