Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (70 species) not a true protein |
Species Bacillus licheniformis [TaxId:1402] [255255] (2 PDB entries) |
Domain d2jena_: 2jen A: [242216] automated match to d1oa2a_ complexed with dio, gol, so4 |
PDB Entry: 2jen (more details), 1.4 Å
SCOPe Domain Sequences for d2jena_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jena_ b.29.1.0 (A:) automated matches {Bacillus licheniformis [TaxId: 1402]} aasssnpsdklyfknkkyyifnnvwgadqvsgwwqtiyhnsdsdmgwvwnwpsntstvka ypsivsgwhwtegytagsgfptrlsdqknintkvsysisangtynaaydiwlhntnkasw dsaptdaimiwlnntnagpagsyvetvsigghswkvykgyidagggkgwnvfsfirtant qsanlnirdftnyladskqwlsktkyvssvefgtevfggtgqinisnwdvtvr
Timeline for d2jena_: