Lineage for d2jena_ (2jen A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2780695Species Bacillus licheniformis [TaxId:1402] [255255] (2 PDB entries)
  8. 2780696Domain d2jena_: 2jen A: [242216]
    automated match to d1oa2a_
    complexed with dio, gol, so4

Details for d2jena_

PDB Entry: 2jen (more details), 1.4 Å

PDB Description: family 12 xyloglucanase from bacillus licheniformis in complex with ligand
PDB Compounds: (A:) endo-beta-1,4-glucanase

SCOPe Domain Sequences for d2jena_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jena_ b.29.1.0 (A:) automated matches {Bacillus licheniformis [TaxId: 1402]}
aasssnpsdklyfknkkyyifnnvwgadqvsgwwqtiyhnsdsdmgwvwnwpsntstvka
ypsivsgwhwtegytagsgfptrlsdqknintkvsysisangtynaaydiwlhntnkasw
dsaptdaimiwlnntnagpagsyvetvsigghswkvykgyidagggkgwnvfsfirtant
qsanlnirdftnyladskqwlsktkyvssvefgtevfggtgqinisnwdvtvr

SCOPe Domain Coordinates for d2jena_:

Click to download the PDB-style file with coordinates for d2jena_.
(The format of our PDB-style files is described here.)

Timeline for d2jena_: