SCOPe 2.07: Domain d2jcsb_: 2jcs B:

Lineage for d2jcsb_ (2jcs B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein automated matches [190087] (15 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [233748] (6 PDB entries)

8. Domain d2jcsb_: 2jcs B: [242215]
   automated match to d2vp4d_
   complexed with mg, ttp; mutant

Details for d2jcsb_

PDB Entry: 2jcs, 2.5 Å

PDB Description: active site mutant of dnk from d. melanogaster with dttp bound

PDB Compounds: (B:) deoxynucleoside kinase

SCOPe Domain Sequences for d2jcsb_:

Sequence; same for both SEQRES and ATOM records:

>d2jcsb_ c.37.1.1 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tkyaegtqpftvliegnigsgkttylnhfekykndiclltdpvekwrnvngvnllelmyk
dpkkwampfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmynt
leewykfieesihvqadliiylrtspevayerirqrarseescvplkylqelhelhedwl
ihqrrpqsckvlvldadl

Timeline for d2jcsb_:

• d2jcsb_ first appeared in SCOPe 2.04
  
• d2jcsb_ appears in SCOPe 2.06
  
• d2jcsb_ appears in the current release, SCOPe 2.08