SCOPe 2.05: Domain d1d2sa_: 1d2s A:

Lineage for d1d2sa_ (1d2s A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.4: Laminin G-like module [49944] (7 proteins)

6. Protein Sex hormone-binding globulin [49945] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49946] (9 PDB entries)

8. Domain d1d2sa_: 1d2s A: [24221]
   complexed with ca, dht

Details for d1d2sa_

PDB Entry: 1d2s, 1.55 Å

PDB Description: crystal structure of the n-terminal laminin g-like domain of shbg in complex with dihydrotestosterone

PDB Compounds: (A:) sex hormone-binding globulin

SCOPe Domain Sequences for d1d2sa_:

Sequence; same for both SEQRES and ATOM records:

>d1d2sa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]}
ppavhlsngpgqepiavmtfdltkitktsssfevrtwdpegvifygdtnpkddwfmlglr
dgrpeiqlhnhwaqltvgagprlddgrwhqvevkmegdsvllevdgeevlrlrqvsghpi
mrialggllfpasnlrlplvpaldgclrrdswldkqaeisasaptslrsc

Timeline for d1d2sa_:

• d1d2sa_ first appeared (with stable ids) in SCOP 1.55
  
• d1d2sa_ appears in SCOPe 2.04
  
• d1d2sa_ appears in SCOPe 2.06
  
• d1d2sa_ appears in the current release, SCOPe 2.08